PCNP Antikörper (Middle Region)

Produktnummer ABIN631140

Produktdetails anti-PCNP Antikörper

Target: PCNP (PEST Proteolytic Signal Containing Nuclear Protein (PCNP))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCNP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCNP antibody was raised against the middle region of PCNP

Aufreinigung: Affinity purified

Immunogen: PCNP antibody was raised using the middle region of PCNP corresponding to a region with amino acids AKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCNP Blocking Peptide, catalog no. 33R-1302, is also available for use as a blocking control in assays to test for specificity of this PCNP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCNP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCNP

Target: PCNP (PEST Proteolytic Signal Containing Nuclear Protein (PCNP))

Andere Bezeichnung: PCNP (PCNP Produkte)

Synonyme: 1110018D06Rik antikoerper, AI647035 antikoerper, PEST proteolytic signal containing nuclear protein antikoerper, PCNP antikoerper, Pcnp antikoerper

Hintergrund: PCNP may be involved in cell cycle regulation.

Molekulargewicht: 19 kDa (MW of target protein)