SNAP23 Antikörper (N-Term)
-
- Target Alle SNAP23 Antikörper anzeigen
- SNAP23 (Synaptosomal-Associated Protein, 23kDa (SNAP23))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SNAP23 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SNAP23 antibody was raised against the N terminal of SNAP23
- Aufreinigung
- Affinity purified
- Immunogen
- SNAP23 antibody was raised using the N terminal of SNAP23 corresponding to a region with amino acids GIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPC
- Top Product
- Discover our top product SNAP23 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SNAP23 Blocking Peptide, catalog no. 33R-3332, is also available for use as a blocking control in assays to test for specificity of this SNAP23 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNAP23 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SNAP23 (Synaptosomal-Associated Protein, 23kDa (SNAP23))
- Andere Bezeichnung
- SNAP23 (SNAP23 Produkte)
- Synonyme
- 23kDa antikoerper, AA408749 antikoerper, SNAP-23 antikoerper, Sndt antikoerper, Syndet antikoerper, HsT17016 antikoerper, SNAP23A antikoerper, SNAP23B antikoerper, XOSNAP-23 antikoerper, snap23-A antikoerper, synaptosome associated protein 23 antikoerper, synaptosome associated protein 23kDa antikoerper, synaptosomal-associated protein 23 antikoerper, synaptosome associated protein 23kDa L homeolog antikoerper, SNAP23 antikoerper, snap23 antikoerper, Snap23 antikoerper, snap23.L antikoerper
- Hintergrund
- SNAP23 is structurally and functionally similar to SNAP25 and binds tightly to multiple syntaxins and synaptobrevins/VAMPs. It is an essential component of the high affinity receptor for the general membrane fusion machinery and is an important regulator of transport vesicle docking and fusion. Two alternative transcript variants encoding different protein isoforms have been described for this genepecificity of vesicular transport is regulated, in part, by the interaction of a vesicle-associated membrane protein termed synaptobrevin/VAMP with a target compartment membrane protein termed syntaxin.
- Molekulargewicht
- 23 kDa (MW of target protein)
-