SNRK Antikörper (Middle Region)

Produktnummer ABIN631138

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch SNRK in WB. Er zeigt eine Reaktivität gegenüber Human und Ratte.

Kurzübersicht für SNRK Antikörper (Middle Region) (ABIN631138)

Target: SNRK (SNF Related Kinase (SNRK))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SNRK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SNRK Antikörper

Bindungsspezifität: Middle Region

Spezifität: SNRK antibody was raised against the middle region of SNRK

Aufreinigung: Affinity purified

Immunogen: SNRK antibody was raised using the middle region of SNRK corresponding to a region with amino acids SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SNRK Blocking Peptide, (ABIN5616319), is also available for use as a blocking control in assays to test for specificity of this SNRK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SNRK

Target: SNRK (SNF Related Kinase (SNRK))

Andere Bezeichnung: SNRK

Hintergrund: SNRK may play a role in hematopoietic cell proliferation or differentiation. SNRK is the potential mediator of neuronal apoptosis.

Molekulargewicht: 84 kDa (MW of target protein)