SNRK Antikörper (Middle Region)

Produktnummer ABIN631138

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SNRK in WB. Er zeigt eine Reaktivität gegenüber Human und Ratte.

Kurzübersicht für SNRK Antikörper (Middle Region) (ABIN631138)

Target: SNRK (SNF Related Kinase (SNRK))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SNRK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SNRK Antikörper

Bindungsspezifität: Middle Region

Spezifität: SNRK antibody was raised against the middle region of SNRK

Aufreinigung: Affinity purified

Immunogen: SNRK antibody was raised using the middle region of SNRK corresponding to a region with amino acids SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SNRK Blocking Peptide, (ABIN5616319), is also available for use as a blocking control in assays to test for specificity of this SNRK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SNRK

Target: SNRK (SNF Related Kinase (SNRK))

Andere Bezeichnung: SNRK

Hintergrund: SNRK may play a role in hematopoietic cell proliferation or differentiation. SNRK is the potential mediator of neuronal apoptosis.

Molekulargewicht: 84 kDa (MW of target protein)