TGS1 Antikörper

Produktnummer ABIN631136

Der Kaninchen Polyklonal anti-TGS1 Antikörper wird verwendet zum Nachweis von TGS1 in Proben von Human und Maus. Er wurde validiert für WB.

Kurzübersicht für TGS1 Antikörper (ABIN631136)

Target: TGS1 (Trimethylguanosine Synthase 1 (TGS1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TGS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TGS1 Antikörper

Aufreinigung: Affinity purified

Immunogen: TGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TGS1 Blocking Peptide, (ABIN939296), is also available for use as a blocking control in assays to test for specificity of this TGS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TGS1

Target: TGS1 (Trimethylguanosine Synthase 1 (TGS1))

Andere Bezeichnung: TGS1

Hintergrund: TGS1 catalyzes the methylation step(s) for the conversion of the 7-monomethylguanosine (m7G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. TGS1 plays a role in transcriptional regulation.

Molekulargewicht: 96 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, Regulation of Lipid Metabolism by PPARalpha, Ribonucleoprotein Complex Subunit Organization