IER5 Antikörper (N-Term)

Produktnummer ABIN631134

Dieses Anti-IER5-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von IER5 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für IER5 Antikörper (N-Term) (ABIN631134)

Target: IER5 (Immediate Early Response 5 (IER5))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IER5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IER5 Antikörper

Bindungsspezifität: N-Term

Spezifität: IER5 antibody was raised against the N terminal of IER5

Aufreinigung: Affinity purified

Immunogen: IER5 antibody was raised using the N terminal of IER5 corresponding to a region with amino acids MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IER5 Blocking Peptide, catalog no. 33R-5913, is also available for use as a blocking control in assays to test for specificity of this IER5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IER5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IER5

Target: IER5 (Immediate Early Response 5 (IER5))

Andere Bezeichnung: IER5

Hintergrund: This gene encodes a protein that is similar to other immediate early response proteins. In the mouse, a similar gene may play an important role in mediating the cellular response to mitogenic signals.

Molekulargewicht: 34 kDa (MW of target protein)