HPD Antikörper (Middle Region)

Produktnummer ABIN631126

Produktdetails anti-HPD Antikörper

Target: HPD (4-Hydroxyphenylpyruvate Dioxygenase (HPD))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HPD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HPD antibody was raised against the middle region of HPD

Aufreinigung: Affinity purified

Immunogen: HPD antibody was raised using the middle region of HPD corresponding to a region with amino acids EMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HPD Blocking Peptide, catalog no. 33R-2584, is also available for use as a blocking control in assays to test for specificity of this HPD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HPD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HPD

Target: HPD (4-Hydroxyphenylpyruvate Dioxygenase (HPD))

Andere Bezeichnung: HPD (HPD Produkte)

Synonyme: fb58f02 antikoerper, hpd antikoerper, wu:fb58f02 antikoerper, zgc:56326 antikoerper, zgc:92456 antikoerper, MGC146689 antikoerper, BA0240 antikoerper, PSPTO3553 antikoerper, DDBDRAFT_0203373 antikoerper, DDBDRAFT_0231603 antikoerper, DDBDRAFT_0231604 antikoerper, DDB_0203373 antikoerper, DDB_0231603 antikoerper, DDB_0231604 antikoerper, hppd antikoerper, 4-HPPD antikoerper, 4HPPD antikoerper, GLOD3 antikoerper, HPPDASE antikoerper, PPD antikoerper, 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE antikoerper, F12K11.9 antikoerper, F12K11_9 antikoerper, HPD antikoerper, P-HYDROXYPHENYLPYRUVATE DIOXYGENASE antikoerper, phytoene desaturation 1 antikoerper, Fla antikoerper, Flp antikoerper, Hppd antikoerper, Laf antikoerper, 4-hydroxyphenylpyruvate dioxygenase a antikoerper, 4-hydroxyphenylpyruvate dioxygenase antikoerper, 4-hydroxyphenylpyruvate dioxygenase b antikoerper, 4-hydroxyphenylpyruvate dioxygenase L homeolog antikoerper, 4-hydroxyphenylpyruvic acid dioxygenase antikoerper, hpda antikoerper, HPD antikoerper, hpdb antikoerper, hpd.L antikoerper, hpd antikoerper, BA_0240 antikoerper, hppD antikoerper, Hpd antikoerper, PDS1 antikoerper

Hintergrund: The protein encoded by this gene is an enzyme in the catabolic pathway of tyrosine. The encoded protein catalyzes the conversion of 4-hydroxyphenylpyruvate to homogentisate. Defects in this gene are a cause of tyrosinemia type 3 (TYRO3) and hawkinsinuria.

Molekulargewicht: 45 kDa (MW of target protein)