PACRG Antikörper (Middle Region)

Produktnummer ABIN631123

Produktdetails anti-PACRG Antikörper

Target: PACRG (PARK2 Co-Regulated (PACRG))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PACRG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PACRG antibody was raised against the middle region of PACRG

Aufreinigung: Affinity purified

Immunogen: PACRG antibody was raised using the middle region of PACRG corresponding to a region with amino acids GAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PACRG Blocking Peptide, catalog no. 33R-3157, is also available for use as a blocking control in assays to test for specificity of this PACRG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PACRG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PACRG

Target: PACRG (PARK2 Co-Regulated (PACRG))

Andere Bezeichnung: PACRG (PACRG Produkte)

Synonyme: PACRG antikoerper, GLUP antikoerper, HAK005771 antikoerper, PARK2CRG antikoerper, RP3-495O10.2 antikoerper, zgc:101786 antikoerper, RGD1561027 antikoerper, 1700008H23Rik antikoerper, parkin coregulated antikoerper, PARK2 co-regulated antikoerper, PARK2 coregulated antikoerper, PACRG antikoerper, pacrg antikoerper, Pacrg antikoerper

Hintergrund: PACRG is a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy.

Molekulargewicht: 33 kDa (MW of target protein)