TUFM Antikörper (Middle Region)

Produktnummer ABIN631117

Produktdetails anti-TUFM Antikörper

Target: TUFM (Tufm) (Tu Translation Elongation Factor, Mitochondrial (Tufm))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TUFM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TUFM antibody was raised against the middle region of TUFM

Aufreinigung: Affinity purified

Immunogen: TUFM antibody was raised using the middle region of TUFM corresponding to a region with amino acids PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TUFM Blocking Peptide, catalog no. 33R-7046, is also available for use as a blocking control in assays to test for specificity of this TUFM antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUFM antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TUFM

Target: TUFM (Tufm) (Tu Translation Elongation Factor, Mitochondrial (Tufm))

Andere Bezeichnung: TUFM (Tufm Produkte)

Synonyme: TUFM antikoerper, D250 antikoerper, fi06f04 antikoerper, wu:fi06f04 antikoerper, zgc:110766 antikoerper, COXPD4 antikoerper, EF-TuMT antikoerper, EFTU antikoerper, P43 antikoerper, 2300002G02Rik antikoerper, C76308 antikoerper, C76389 antikoerper, Tu translation elongation factor, mitochondrial antikoerper, TUFM antikoerper, tufm antikoerper, Tufm antikoerper

Hintergrund: TUFM is a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy.

Molekulargewicht: 50 kDa (MW of target protein)