TUFM Antikörper (Middle Region)

Produktnummer ABIN631117

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TUFM in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für TUFM Antikörper (Middle Region) (ABIN631117)

Target: TUFM (Tufm) (Tu Translation Elongation Factor, Mitochondrial (Tufm))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TUFM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TUFM Antikörper

Bindungsspezifität: Middle Region

Spezifität: TUFM antibody was raised against the middle region of TUFM

Aufreinigung: Affinity purified

Immunogen: TUFM antibody was raised using the middle region of TUFM corresponding to a region with amino acids PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TUFM Blocking Peptide, (ABIN5616846), is also available for use as a blocking control in assays to test for specificity of this TUFM antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUFM antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TUFM

Target: TUFM (Tufm) (Tu Translation Elongation Factor, Mitochondrial (Tufm))

Andere Bezeichnung: TUFM

Hintergrund: TUFM is a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy.

Molekulargewicht: 50 kDa (MW of target protein)