ACADL Antikörper (N-Term)

Produktnummer ABIN631116

Produktdetails anti-ACADL Antikörper

Target: ACADL (Acyl-CoA Dehydrogenase, Long Chain (ACADL))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACADL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACADL antibody was raised against the N terminal of ACADL

Aufreinigung: Affinity purified

Immunogen: ACADL antibody was raised using the N terminal of ACADL corresponding to a region with amino acids MAARLLRGSLRVLGGHRAPRQLPAARCSHSGGEERLETPSAKKLTDIGIR

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACADL Blocking Peptide, catalog no. 33R-5609, is also available for use as a blocking control in assays to test for specificity of this ACADL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACADL

Target: ACADL (Acyl-CoA Dehydrogenase, Long Chain (ACADL))

Andere Bezeichnung: ACADL (ACADL Produkte)

Synonyme: zgc:55656 antikoerper, ACAD4 antikoerper, LCAD antikoerper, ACOADA antikoerper, AA960361 antikoerper, AU018452 antikoerper, C79855 antikoerper, acyl-CoA dehydrogenase long chain antikoerper, acyl-CoA dehydrogenase, long chain antikoerper, acyl-CoA dehydrogenase, long chain L homeolog antikoerper, acyl-Coenzyme A dehydrogenase, long-chain antikoerper, acadl antikoerper, ACADL antikoerper, Acadl antikoerper, acadl.L antikoerper

Hintergrund: ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in ACADL gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process