RPS21 Antikörper (N-Term)

Produktnummer ABIN631108

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RPS21 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für RPS21 Antikörper (N-Term) (ABIN631108)

Target: RPS21 (Ribosomal Protein S21 (RPS21))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPS21 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RPS21 Antikörper

Bindungsspezifität: N-Term

Spezifität: RPS21 antibody was raised against the N terminal of RPS21

Aufreinigung: Affinity purified

Immunogen: RPS21 antibody was raised using the N terminal of RPS21 corresponding to a region with amino acids MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPS21 Blocking Peptide, (ABIN5615947), is also available for use as a blocking control in assays to test for specificity of this RPS21 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS21 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPS21

Target: RPS21 (Ribosomal Protein S21 (RPS21))

Andere Bezeichnung: RPS21

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molekulargewicht: 9 kDa (MW of target protein)