MTCH2 Antikörper

Produktnummer ABIN631106

Der Kaninchen Polyklonal Anti-MTCH2-Antikörper wurde für WB validiert. Er ist geeignet, MTCH2 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für MTCH2 Antikörper (ABIN631106)

Target: MTCH2 (Mitochondrial Carrier 2 (MTCH2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MTCH2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MTCH2 Antikörper

Aufreinigung: Affinity purified

Immunogen: MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MTCH2 Blocking Peptide, catalog no. 33R-1082, is also available for use as a blocking control in assays to test for specificity of this MTCH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTCH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MTCH2

Target: MTCH2 (Mitochondrial Carrier 2 (MTCH2))

Andere Bezeichnung: MTCH2

Hintergrund: MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats. The substrate transported is not yet known. It induces mitochondrial depolarization.

Molekulargewicht: 33 kDa (MW of target protein)