ACADSB Antikörper (Middle Region)

Produktnummer ABIN631104

Produktdetails anti-ACADSB Antikörper

Target: ACADSB (Acyl-CoA Dehydrogenase, Short/branched Chain (ACADSB))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACADSB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACADSB antibody was raised against the middle region of ACADSB

Aufreinigung: Affinity purified

Immunogen: ACADSB antibody was raised using the middle region of ACADSB corresponding to a region with amino acids GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACADSB Blocking Peptide, catalog no. 33R-3416, is also available for use as a blocking control in assays to test for specificity of this ACADSB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADSB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACADSB

Target: ACADSB (Acyl-CoA Dehydrogenase, Short/branched Chain (ACADSB))

Andere Bezeichnung: ACADSB (ACADSB Produkte)

Hintergrund: Short/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. ACADSB has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process