SPATA5 Antikörper (Middle Region)
-
- Target Alle SPATA5 Antikörper anzeigen
- SPATA5 (Spermatogenesis Associated 5 (SPATA5))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SPATA5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SPATA5 antibody was raised against the middle region of SPATA5
- Aufreinigung
- Affinity purified
- Immunogen
- SPATA5 antibody was raised using the middle region of SPATA5 corresponding to a region with amino acids ALLALEEDIQANLIMKRHFTQALSTVTPRIPESLRRFYEDYQEKSGLHTL
- Top Product
- Discover our top product SPATA5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SPATA5 Blocking Peptide, catalog no. 33R-1347, is also available for use as a blocking control in assays to test for specificity of this SPATA5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPATA5 (Spermatogenesis Associated 5 (SPATA5))
- Andere Bezeichnung
- SPATA5 (SPATA5 Produkte)
- Synonyme
- AFG2 antikoerper, SPAF antikoerper, 2510048F20Rik antikoerper, C78064 antikoerper, Spaf antikoerper, spermatogenesis associated 5 antikoerper, SPATA5 antikoerper, Spata5 antikoerper
- Hintergrund
- SPATA5 may be involved in morphological and functional mitochondrial transformations during spermatogenesis.
- Molekulargewicht
- 98 kDa (MW of target protein)
-