SPATA5 Antikörper (Middle Region)

Produktnummer ABIN631101

Dieses Anti-SPATA5-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SPATA5 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für SPATA5 Antikörper (Middle Region) (ABIN631101)

Target: SPATA5 (Spermatogenesis Associated 5 (SPATA5))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPATA5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SPATA5 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SPATA5 antibody was raised against the middle region of SPATA5

Aufreinigung: Affinity purified

Immunogen: SPATA5 antibody was raised using the middle region of SPATA5 corresponding to a region with amino acids ALLALEEDIQANLIMKRHFTQALSTVTPRIPESLRRFYEDYQEKSGLHTL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPATA5 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SPATA5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPATA5

Target: SPATA5 (Spermatogenesis Associated 5 (SPATA5))

Andere Bezeichnung: SPATA5

Hintergrund: SPATA5 may be involved in morphological and functional mitochondrial transformations during spermatogenesis.

Molekulargewicht: 98 kDa (MW of target protein)