GLYATL2 Antikörper (Middle Region)

Produktnummer ABIN631098

Dieses Anti-GLYATL2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von GLYATL2 in WB. Geeignet für Human.

Kurzübersicht für GLYATL2 Antikörper (Middle Region) (ABIN631098)

Target: GLYATL2 (Glycine-N-Acyltransferase-Like 2 (GLYATL2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GLYATL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GLYATL2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: GLYATL2 antibody was raised against the middle region of GLYATL2

Aufreinigung: Affinity purified

Immunogen: GLYATL2 antibody was raised using the middle region of GLYATL2 corresponding to a region with amino acids LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GLYATL2 Blocking Peptide, (ABIN940229), is also available for use as a blocking control in assays to test for specificity of this GLYATL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLYATL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GLYATL2

Target: GLYATL2 (Glycine-N-Acyltransferase-Like 2 (GLYATL2))

Andere Bezeichnung: GLYATL2

Hintergrund: GLYATL2 belongs to the glycine N-acyltransferase family. GLYATL2 is a mitochondrial acyltransferase which transfers the acyl group to the N-terminus of glycine. It can conjugate a multitude of substrates to form a variety of N-acylglycines.

Molekulargewicht: 34 kDa (MW of target protein)