Aminomethyltransferase Antikörper (N-Term)

Produktnummer ABIN631086

Produktdetails anti-Aminomethyltransferase Antikörper

Target: Aminomethyltransferase (AMT)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Aminomethyltransferase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AMT antibody was raised against the N terminal of AMT

Aufreinigung: Affinity purified

Immunogen: AMT antibody was raised using the N terminal of AMT corresponding to a region with amino acids QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AMT Blocking Peptide, catalog no. 33R-7703, is also available for use as a blocking control in assays to test for specificity of this AMT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Aminomethyltransferase

Target: Aminomethyltransferase (AMT)

Andere Bezeichnung: AMT (AMT Produkte)

Synonyme: F16J13.200 antikoerper, F16J13_200 antikoerper, T7P1.13 antikoerper, T7P1_13 antikoerper, wu:fc31f04 antikoerper, wu:fd44b12 antikoerper, wu:fd54h12 antikoerper, zgc:103483 antikoerper, zgc:109741 antikoerper, GCE antikoerper, GCST antikoerper, GCVT antikoerper, NKH antikoerper, EG434437 antikoerper, aminomethyltransferase antikoerper, Glycine cleavage T-protein family antikoerper, Aminomethyltransferase antikoerper, aminomethyltransferase L homeolog antikoerper, AMT antikoerper, AT4G12130 antikoerper, AT1G60990 antikoerper, Tb11.01.1440 antikoerper, Palpr_0614 antikoerper, Ocepr_1643 antikoerper, Celal_2914 antikoerper, Deima_1002 antikoerper, Deipr_1956 antikoerper, Bacsa_3405 antikoerper, Celly_0288 antikoerper, Weevi_0527 antikoerper, Fluta_3952 antikoerper, Marky_0785 antikoerper, Spico_1217 antikoerper, Poras_1228 antikoerper, Halhy_3617 antikoerper, amt antikoerper, amt.L antikoerper, Amt antikoerper

Hintergrund: The enzyme system for cleavage of glycine (glycine cleavage system, EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). Glycine encephalopathy (GCE) may be due to a defect in any one of these enzymes.

Molekulargewicht: 44 kDa (MW of target protein)