Aminomethyltransferase Antikörper (N-Term)

Produktnummer ABIN631086

Dieses Anti-Aminomethyltransferase-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Aminomethyltransferase in WB. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für Aminomethyltransferase Antikörper (N-Term) (ABIN631086)

Target: Aminomethyltransferase (AMT)

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Aminomethyltransferase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Aminomethyltransferase Antikörper

Bindungsspezifität: N-Term

Spezifität: AMT antibody was raised against the N terminal of AMT

Aufreinigung: Affinity purified

Immunogen: AMT antibody was raised using the N terminal of AMT corresponding to a region with amino acids QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AMT Blocking Peptide, (ABIN5612052), is also available for use as a blocking control in assays to test for specificity of this AMT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Aminomethyltransferase

Target: Aminomethyltransferase (AMT)

Andere Bezeichnung: AMT

Hintergrund: The enzyme system for cleavage of glycine (glycine cleavage system, EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). Glycine encephalopathy (GCE) may be due to a defect in any one of these enzymes.

Molekulargewicht: 44 kDa (MW of target protein)