Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

Aminomethyltransferase Antikörper (N-Term)

Dieses Anti-Aminomethyltransferase-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Aminomethyltransferase in WB. Geeignet für Human, Maus, Ratte und Hund.
Produktnummer ABIN631086

Kurzübersicht für Aminomethyltransferase Antikörper (N-Term) (ABIN631086)

Target

Alle Aminomethyltransferase (AMT) Antikörper anzeigen
Aminomethyltransferase (AMT)

Reaktivität

  • 25
  • 7
  • 6
  • 3
  • 2
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
Human, Maus, Ratte, Hund

Wirt

  • 21
  • 4
Kaninchen

Klonalität

  • 23
  • 2
Polyklonal

Konjugat

  • 21
  • 2
  • 1
  • 1
Dieser Aminomethyltransferase Antikörper ist unkonjugiert

Applikation

  • 20
  • 9
  • 6
  • 3
  • 2
  • 2
  • 1
  • 1
Western Blotting (WB)
  • Bindungsspezifität

    • 7
    • 5
    • 4
    • 2
    • 2
    • 1
    N-Term

    Spezifität

    AMT antibody was raised against the N terminal of AMT

    Aufreinigung

    Affinity purified

    Immunogen

    AMT antibody was raised using the N terminal of AMT corresponding to a region with amino acids QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    AMT Blocking Peptide, (ABIN5612052), is also available for use as a blocking control in assays to test for specificity of this AMT antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMT antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    Aminomethyltransferase (AMT)

    Andere Bezeichnung

    AMT

    Hintergrund

    The enzyme system for cleavage of glycine (glycine cleavage system, EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). Glycine encephalopathy (GCE) may be due to a defect in any one of these enzymes.

    Molekulargewicht

    44 kDa (MW of target protein)
Sie sind hier:
Chat with us!