NAD-ME Antikörper
Kurzübersicht für NAD-ME Antikörper (ABIN631085)
Target
Alle NAD-ME Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Aufreinigung
- Affinity purified
-
Immunogen
- ME2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMG
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
ME2 Blocking Peptide, (ABIN5614716), is also available for use as a blocking control in assays to test for specificity of this ME2 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ME2 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
- Avoid repeated freeze/thaw cycles.
-
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- NAD-ME (NAD Dependent Malate Dehydrogenase (NAD-ME))
-
Andere Bezeichnung
- ME2
-
Hintergrund
- ME2 is a mitochondrial NAD-dependent malic enzyme, a homotetrameric protein, that catalyzes the oxidative decarboxylation of malate to pyruvate. It had previously been weakly linked to a syndrome known as Friedreich ataxia that has since been shown to be the result of mutation in a completely different gene.
-
Molekulargewicht
- 65 kDa (MW of target protein)
-
Pathways
- Production of Molecular Mediator of Immune Response
Target
-