PCCA Antikörper (N-Term)

Produktnummer ABIN631082

Der Kaninchen Polyklonal Anti-PCCA-Antikörper wurde für WB validiert. Er ist geeignet, PCCA in Proben von Human zu detektieren.

Kurzübersicht für PCCA Antikörper (N-Term) (ABIN631082)

Target: PCCA (Propionyl CoA Carboxylase, alpha Polypeptide (PCCA))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCCA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PCCA Antikörper

Bindungsspezifität: N-Term

Spezifität: PCCA antibody was raised against the N terminal of PCCA

Aufreinigung: Affinity purified

Immunogen: PCCA antibody was raised using the N terminal of PCCA corresponding to a region with amino acids LYYSRQCLMVSRNLGSVGYDPNEKTFDKILVANRGEIACRVIRTCKKMGI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCCA Blocking Peptide, (ABIN5615238), is also available for use as a blocking control in assays to test for specificity of this PCCA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCCA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCCA

Target: PCCA (Propionyl CoA Carboxylase, alpha Polypeptide (PCCA))

Andere Bezeichnung: PCCA

Hintergrund: PCCA is the alpha subunit of the heterodimeric mitochondrial enzyme Propionyl-CoA carboxylase. PCCA is the biotin-binding region of this enzyme. Mutations in either PCCA or PCCB (encoding the beta subunit) lead to an enzyme deficiency resulting in propionic acidemia.

Molekulargewicht: 75 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process