DLAT Antikörper (C-Term)

Produktnummer ABIN631076

Der Kaninchen Polyklonal Anti-DLAT-Antikörper wurde für WB validiert. Er ist geeignet, DLAT in Proben von Human, Maus, Ratte und C. elegans zu detektieren.

Kurzübersicht für DLAT Antikörper (C-Term) (ABIN631076)

Target: DLAT (Dihydrolipoyl Transacetylase (DLAT))

Reaktivität: Human, Maus, Ratte, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DLAT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DLAT Antikörper

Bindungsspezifität: C-Term

Spezifität: DLAT antibody was raised against the C terminal of DLAT

Aufreinigung: Affinity purified

Immunogen: DLAT antibody was raised using the C terminal of DLAT corresponding to a region with amino acids DVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DLAT Blocking Peptide, (ABIN937613), is also available for use as a blocking control in assays to test for specificity of this DLAT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLAT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DLAT

Target: DLAT (Dihydrolipoyl Transacetylase (DLAT))

Andere Bezeichnung: DLAT

Hintergrund: DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT.

Molekulargewicht: 69 kDa (MW of target protein)