HADHB Antikörper
-
- Target Alle HADHB Antikörper anzeigen
- HADHB (Hydroxyacyl-CoA Dehydrogenase/3-Ketoacyl-CoA Thiolase/enoyl-CoA Hydratase (Trifunctional Protein), beta Subunit (HADHB))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HADHB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- HADHB antibody was raised using a synthetic peptide corresponding to a region with amino acids LLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAE
- Top Product
- Discover our top product HADHB Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.2-1 µg/mL, IHC: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HADHB Blocking Peptide, catalog no. 33R-5158, is also available for use as a blocking control in assays to test for specificity of this HADHB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HADHB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HADHB (Hydroxyacyl-CoA Dehydrogenase/3-Ketoacyl-CoA Thiolase/enoyl-CoA Hydratase (Trifunctional Protein), beta Subunit (HADHB))
- Andere Bezeichnung
- HADHB (HADHB Produkte)
- Synonyme
- ECHB antikoerper, MTPB antikoerper, TP-BETA antikoerper, thiolase antikoerper, fb14g10 antikoerper, wu:fb14g10 antikoerper, zgc:56274 antikoerper, 4930479F15Rik antikoerper, Mtpb antikoerper, Hadhb antikoerper, hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta antikoerper, hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta S homeolog antikoerper, hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit antikoerper, hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit antikoerper, HADHB antikoerper, hadhb.S antikoerper, Hadhb antikoerper, hadhb antikoerper
- Hintergrund
- HADHB is the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. Mutations in HADHB gene result in trifunctional protein deficiency. The protein can also bind RNA and decreases the stability of some mRNAs.
- Molekulargewicht
- 47 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-