HADHB Antikörper

Produktnummer ABIN631070

Der Kaninchen Polyklonal anti-HADHB Antikörper wird verwendet zum Nachweis von HADHB in Proben von Human, Maus und Ratte. Er wurde validiert für WB und IHC.

Kurzübersicht für HADHB Antikörper (ABIN631070)

Target: HADHB (Hydroxyacyl-CoA Dehydrogenase/3-Ketoacyl-CoA Thiolase/enoyl-CoA Hydratase (Trifunctional Protein), beta Subunit (HADHB))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HADHB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-HADHB Antikörper

Aufreinigung: Affinity purified

Immunogen: HADHB antibody was raised using a synthetic peptide corresponding to a region with amino acids LLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAE

Anwendungsinformationen

Applikationshinweise: WB: 0.2-1 µg/mL, IHC: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HADHB Blocking Peptide, (ABIN940544), is also available for use as a blocking control in assays to test for specificity of this HADHB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HADHB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HADHB

Target: HADHB (Hydroxyacyl-CoA Dehydrogenase/3-Ketoacyl-CoA Thiolase/enoyl-CoA Hydratase (Trifunctional Protein), beta Subunit (HADHB))

Andere Bezeichnung: HADHB

Hintergrund: HADHB is the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. Mutations in HADHB gene result in trifunctional protein deficiency. The protein can also bind RNA and decreases the stability of some mRNAs.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process