Catenin Antikörper

Produktnummer ABIN631064

Der Kaninchen Polyklonal Anti-Catenin-Antikörper wurde für WB validiert. Er ist geeignet, Catenin in Proben von Human zu detektieren.

Kurzübersicht für Catenin Antikörper (ABIN631064)

Target: Catenin

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Catenin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Catenin Antikörper

Aufreinigung: Affinity purified

Immunogen: Catenin antibody was raised using a synthetic peptide corresponding to a region with amino acids QTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Catenin Blocking Peptide, (ABIN5612668), is also available for use as a blocking control in assays to test for specificity of this Catenin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTNND1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Catenin

Target: Catenin

Hintergrund: This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and althernative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined.

Molekulargewicht: 108 kDa (MW of target protein)