HADH Antikörper (C-Term)

Produktnummer ABIN631059

Dieses Anti-HADH-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von HADH in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für HADH Antikörper (C-Term) (ABIN631059)

Target: HADH (Hydroxyacyl-CoA Dehydrogenase (HADH))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HADH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HADH Antikörper

Bindungsspezifität: C-Term

Spezifität: HADH antibody was raised against the C terminal of HADH

Aufreinigung: Affinity purified

Immunogen: HADH antibody was raised using the C terminal of HADH corresponding to a region with amino acids YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HADH Blocking Peptide, (ABIN936175), is also available for use as a blocking control in assays to test for specificity of this HADH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HADH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HADH

Target: HADH (Hydroxyacyl-CoA Dehydrogenase (HADH))

Andere Bezeichnung: HADH

Hintergrund: HADH functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, Monocarboxylic Acid Catabolic Process