FTCD Antikörper (Middle Region)

Produktnummer ABIN631049

Der Kaninchen Polyklonal Anti-FTCD-Antikörper wurde für WB validiert. Er ist geeignet, FTCD in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für FTCD Antikörper (Middle Region) (ABIN631049)

Target: FTCD (Formiminotransferase Cyclodeaminase (FTCD))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FTCD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FTCD Antikörper

Bindungsspezifität: Middle Region

Spezifität: FTCD antibody was raised against the middle region of FTCD

Aufreinigung: Affinity purified

Immunogen: FTCD antibody was raised using the middle region of FTCD corresponding to a region with amino acids KFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FTCD Blocking Peptide, (ABIN939759), is also available for use as a blocking control in assays to test for specificity of this FTCD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTCD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FTCD

Target: FTCD (Formiminotransferase Cyclodeaminase (FTCD))

Andere Bezeichnung: FTCD

Hintergrund: FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.

Molekulargewicht: 59 kDa (MW of target protein)