ISCA2 Antikörper

Produktnummer ABIN631044

Dieser Anti-ISCA2 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von ISCA2 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für ISCA2 Antikörper (ABIN631044)

Target: ISCA2 (Iron-Sulfur Cluster Assembly 2 Homolog (ISCA2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ISCA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ISCA2 Antikörper

Aufreinigung: Affinity purified

Immunogen: ISCA2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ISCA2 Blocking Peptide, (ABIN5614217), is also available for use as a blocking control in assays to test for specificity of this ISCA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ISCA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ISCA2

Target: ISCA2 (Iron-Sulfur Cluster Assembly 2 Homolog (ISCA2))

Andere Bezeichnung: ISCA2

Hintergrund: ISCA2 is involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly.

Molekulargewicht: 16 kDa (MW of target protein)