AIFM3 Antikörper (Middle Region)

Produktnummer ABIN631043

Produktdetails anti-AIFM3 Antikörper

Target: AIFM3 (Apoptosis-Inducing Factor, Mitochondrion-Associated, 3 (AIFM3))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AIFM3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AIFM3 antibody was raised against the middle region of AIFM3

Aufreinigung: Affinity purified

Immunogen: AIFM3 antibody was raised using the middle region of AIFM3 corresponding to a region with amino acids EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AIFM3 Blocking Peptide, catalog no. 33R-2429, is also available for use as a blocking control in assays to test for specificity of this AIFM3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AIFM3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AIFM3

Target: AIFM3 (Apoptosis-Inducing Factor, Mitochondrion-Associated, 3 (AIFM3))

Andere Bezeichnung: AIFM3 (AIFM3 Produkte)

Synonyme: nfrl-A antikoerper, MGC84340 antikoerper, AIFM3 antikoerper, LOC100150876 antikoerper, 2810401C16Rik antikoerper, AI840249 antikoerper, Aifl antikoerper, RGD1306028 antikoerper, AIFL antikoerper, apoptosis inducing factor, mitochondria associated 3 L homeolog antikoerper, apoptosis inducing factor, mitochondria associated 3 antikoerper, apoptosis-inducing factor, mitochondrion-associated 3 antikoerper, aifm3.L antikoerper, AIFM3 antikoerper, aifm3 antikoerper, Aifm3 antikoerper

Hintergrund: AIFM3 induces apoptosis through a caspase dependent pathway. AIFM3 reduces mitochondrial membrane potential.

Molekulargewicht: 67 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis