ACAT1 Antikörper (Middle Region)
-
- Target Alle ACAT1 Antikörper anzeigen
- ACAT1 (Acetyl-CoA Acetyltransferase 1 (ACAT1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACAT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACAT1 antibody was raised against the middle region of ACAT1
- Aufreinigung
- Affinity purified
- Immunogen
- ACAT1 antibody was raised using the middle region of ACAT1 corresponding to a region with amino acids GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH
- Top Product
- Discover our top product ACAT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACAT1 Blocking Peptide, catalog no. 33R-3310, is also available for use as a blocking control in assays to test for specificity of this ACAT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACAT1 (Acetyl-CoA Acetyltransferase 1 (ACAT1))
- Andere Bezeichnung
- ACAT1 (ACAT1 Produkte)
- Synonyme
- ACAT antikoerper, MAT antikoerper, T2 antikoerper, THIL antikoerper, RATACAL antikoerper, 6330585C21Rik antikoerper, Acat antikoerper, fd16h07 antikoerper, fd20g06 antikoerper, wu:fd16h07 antikoerper, wu:fd20g06 antikoerper, zgc:86832 antikoerper, acat1-a antikoerper, acetyl-CoA acetyltransferase 1 antikoerper, acetyl-Coenzyme A acetyltransferase 1 antikoerper, acetyl-CoA acetyltransferase 1 L homeolog antikoerper, ACAT1 antikoerper, Acat1 antikoerper, acat1 antikoerper, acat1.L antikoerper
- Hintergrund
- ACAT1 is a mitochondrially localized enzyme that catalyzes the reversible formation of acetoacetyl-CoA from two molecules of acetyl-CoA. The gene encoding ACAT1 spans approximately 27 kb and contains 12 exons interrupted by 11 introns. Defects in this gene are associated with the alpha-methylacetoaceticaciduria disorder, an inborn error of isoleucine catabolism characterized by urinary excretion of 2-methyl-3-hydroxybutyric acid, 2-methylacetoacetic acid, tiglylglycine, and butanone.
- Molekulargewicht
- 41 kDa (MW of target protein)
-