ACAT1 Antikörper (Middle Region)

Produktnummer ABIN631041

Dieser Anti-ACAT1 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von ACAT1 in WB. Geeignet für Human.

Kurzübersicht für ACAT1 Antikörper (Middle Region) (ABIN631041)

Target: ACAT1 (Acetyl-CoA Acetyltransferase 1 (ACAT1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACAT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACAT1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ACAT1 antibody was raised against the middle region of ACAT1

Aufreinigung: Affinity purified

Immunogen: ACAT1 antibody was raised using the middle region of ACAT1 corresponding to a region with amino acids GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACAT1 Blocking Peptide, (ABIN938696), is also available for use as a blocking control in assays to test for specificity of this ACAT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACAT1

Target: ACAT1 (Acetyl-CoA Acetyltransferase 1 (ACAT1))

Andere Bezeichnung: ACAT1

Hintergrund: ACAT1 is a mitochondrially localized enzyme that catalyzes the reversible formation of acetoacetyl-CoA from two molecules of acetyl-CoA. The gene encoding ACAT1 spans approximately 27 kb and contains 12 exons interrupted by 11 introns. Defects in this gene are associated with the alpha-methylacetoaceticaciduria disorder, an inborn error of isoleucine catabolism characterized by urinary excretion of 2-methyl-3-hydroxybutyric acid, 2-methylacetoacetic acid, tiglylglycine, and butanone.

Molekulargewicht: 41 kDa (MW of target protein)