GLYAT Antikörper (N-Term)

Produktnummer ABIN631040

Produktdetails anti-GLYAT Antikörper

Target: GLYAT (Glycine N-Acyltransferase (GLYAT))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GLYAT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GLYAT antibody was raised against the N terminal of GLYAT

Aufreinigung: Affinity purified

Immunogen: GLYAT antibody was raised using the N terminal of GLYAT corresponding to a region with amino acids HYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GLYAT Blocking Peptide, catalog no. 33R-3880, is also available for use as a blocking control in assays to test for specificity of this GLYAT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLYAT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GLYAT

Target: GLYAT (Glycine N-Acyltransferase (GLYAT))

Andere Bezeichnung: GLYAT (GLYAT Produkte)

Synonyme: ACGNAT antikoerper, CAT antikoerper, GAT antikoerper, A330009E03Rik antikoerper, AI195249 antikoerper, AI315345 antikoerper, glycine-N-acyltransferase antikoerper, GLYAT antikoerper, Glyat antikoerper

Hintergrund: The glycine-N-acyltransferase protein conjugates glycine with acyl-CoA substrates in the mitochondria. The protein is thought to be important in the detoxification of endogenous and xenobiotic acyl-CoA's.

Molekulargewicht: 34 kDa (MW of target protein)