Monoamine Oxidase A Antikörper (N-Term)

Produktnummer ABIN631037

Produktdetails anti-Monoamine Oxidase A Antikörper

Target: Monoamine Oxidase A (MAOA)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Monoamine Oxidase A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAOA antibody was raised against the N terminal of MAOA

Aufreinigung: Affinity purified

Immunogen: MAOA antibody was raised using the N terminal of MAOA corresponding to a region with amino acids GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAOA Blocking Peptide, catalog no. 33R-3485, is also available for use as a blocking control in assays to test for specificity of this MAOA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAOA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Monoamine Oxidase A

Target: Monoamine Oxidase A (MAOA)

Andere Bezeichnung: MAOA (MAOA Produkte)

Synonyme: MAO-A antikoerper, 1110061B18Rik antikoerper, AA407771 antikoerper, Mao antikoerper, MAOA antikoerper, LOC100221249 antikoerper, Z-MAO antikoerper, maob antikoerper, moa antikoerper, wu:fb68b05 antikoerper, wu:fo76d11 antikoerper, wu:fq38g06 antikoerper, zgc:85761 antikoerper, monoamine oxidase A antikoerper, monoamine oxidase A L homeolog antikoerper, amine oxidase [flavin-containing] A antikoerper, monoamine oxidase antikoerper, MAOA antikoerper, Maoa antikoerper, maoa.L antikoerper, mll3668 antikoerper, maoa antikoerper, LOC100221249 antikoerper, mao antikoerper

Hintergrund: MAOA catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.

Molekulargewicht: 60 kDa (MW of target protein)