Monoamine Oxidase A Antikörper (N-Term)
Kurzübersicht für Monoamine Oxidase A Antikörper (N-Term) (ABIN631037)
Target
Alle Monoamine Oxidase A (MAOA) Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- MAOA antibody was raised against the N terminal of MAOA
-
Aufreinigung
- Affinity purified
-
Immunogen
- MAOA antibody was raised using the N terminal of MAOA corresponding to a region with amino acids GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
MAOA Blocking Peptide, (ABIN938871), is also available for use as a blocking control in assays to test for specificity of this MAOA antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAOA antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- Monoamine Oxidase A (MAOA)
-
Andere Bezeichnung
- MAOA
-
Hintergrund
- MAOA catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.
-
Molekulargewicht
- 60 kDa (MW of target protein)
Target
-