TRMU Antikörper (C-Term)

Produktnummer ABIN631035

Produktdetails anti-TRMU Antikörper

Target: TRMU (tRNA 5-Methylaminomethyl-2-Thiouridylate Methyltransferase (TRMU))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRMU Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRMU antibody was raised against the C terminal of TRMU

Aufreinigung: Affinity purified

Immunogen: TRMU antibody was raised using the C terminal of TRMU corresponding to a region with amino acids ALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRMU Blocking Peptide, catalog no. 33R-1321, is also available for use as a blocking control in assays to test for specificity of this TRMU antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRMU antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRMU

Target: TRMU (tRNA 5-Methylaminomethyl-2-Thiouridylate Methyltransferase (TRMU))

Andere Bezeichnung: TRMU (TRMU Produkte)

Synonyme: MTO2 antikoerper, MTU1 antikoerper, TRMT antikoerper, TRMT1 antikoerper, TRNT1 antikoerper, 1110005N20Rik antikoerper, 1600025P05Rik antikoerper, AI314320 antikoerper, Trmt1 antikoerper, zgc:110555 antikoerper, tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase antikoerper, TRMU antikoerper, Trmu antikoerper, trmu antikoerper

Hintergrund: TRMU is a member of the trmU family. It is a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.

Molekulargewicht: 48 kDa (MW of target protein)