TRMU Antikörper (C-Term)

Produktnummer ABIN631035

Dieses Anti-TRMU-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von TRMU in WB. Geeignet für Human.

Kurzübersicht für TRMU Antikörper (C-Term) (ABIN631035)

Target: TRMU (tRNA 5-Methylaminomethyl-2-Thiouridylate Methyltransferase (TRMU))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRMU Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TRMU Antikörper

Bindungsspezifität: C-Term

Spezifität: TRMU antibody was raised against the C terminal of TRMU

Aufreinigung: Affinity purified

Immunogen: TRMU antibody was raised using the C terminal of TRMU corresponding to a region with amino acids ALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRMU Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TRMU antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRMU antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRMU

Target: TRMU (tRNA 5-Methylaminomethyl-2-Thiouridylate Methyltransferase (TRMU))

Andere Bezeichnung: TRMU

Hintergrund: TRMU is a member of the trmU family. It is a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.

Molekulargewicht: 48 kDa (MW of target protein)