P5CS Antikörper (N-Term)

Produktnummer ABIN631032

Dieses Anti-P5CS-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von P5CS in WB. Geeignet für Human.

Kurzübersicht für P5CS Antikörper (N-Term) (ABIN631032)

Target: P5CS (ALDH18A1) (Aldehyde Dehydrogenase 18 Family, Member A1 (ALDH18A1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser P5CS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-P5CS Antikörper

Bindungsspezifität: N-Term

Spezifität: ALDH18 A1 antibody was raised against the N terminal of ALDH18 1

Aufreinigung: Affinity purified

Immunogen: ALDH18 A1 antibody was raised using the N terminal of ALDH18 1 corresponding to a region with amino acids SVIRHVRSWSNIPFITVPLSRTHGKSFAHRSELKHAKRIVVKLGSAVVTR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALDH18A1 Blocking Peptide, (ABIN5612007), is also available for use as a blocking control in assays to test for specificity of this ALDH18A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH10 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu P5CS

Target: P5CS (ALDH18A1) (Aldehyde Dehydrogenase 18 Family, Member A1 (ALDH18A1))

Andere Bezeichnung: ALDH18A1

Hintergrund: This gene is a member of the aldehyde dehydrogenase family and encodes a bifunctional ATP- and NADPH-dependent mitochondrial enzyme with both gamma-glutamyl kinase and gamma-glutamyl phosphate reductase activities. The encoded protein catalyzes the reduction of glutamate to delta1-pyrroline-5-carboxylate, a critical step in the de novo biosynthesis of proline, ornithine and arginine. Mutations in this gene lead to hyperammonemia, hypoornithinemia, hypocitrullinemia, hypoargininemia and hypoprolinemia and may be associated with neurodegeneration, cataracts and connective tissue diseases.

Molekulargewicht: 87 kDa (MW of target protein)