ETFB Antikörper (C-Term)

Produktnummer ABIN631031

Produktdetails anti-ETFB Antikörper

Target: ETFB (Electron-Transfer-Flavoprotein, beta Polypeptide (ETFB))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ETFB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ETFB antibody was raised against the C terminal of ETFB

Aufreinigung: Affinity purified

Immunogen: ETFB antibody was raised using the C terminal of ETFB corresponding to a region with amino acids TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ETFB Blocking Peptide, catalog no. 33R-8967, is also available for use as a blocking control in assays to test for specificity of this ETFB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ETFB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ETFB

Target: ETFB (Electron-Transfer-Flavoprotein, beta Polypeptide (ETFB))

Andere Bezeichnung: ETFB (ETFB Produkte)

Synonyme: MWF20.14 antikoerper, MWF20_14 antikoerper, electron transfer flavoprotein beta antikoerper, 0610009I16Rik antikoerper, 2810441H06Rik antikoerper, MADD antikoerper, electron transfer flavoprotein beta antikoerper, electron transfer flavoprotein subunit beta antikoerper, electron transferring flavoprotein, beta polypeptide antikoerper, electron transfer flavoprotein beta subunit L homeolog antikoerper, electron transfer flavoprotein beta subunit antikoerper, ETFBETA antikoerper, FixA antikoerper, Etfb antikoerper, etfb.L antikoerper, ETFB antikoerper

Hintergrund: ETFB is the electron-transfer-flavoprotein, beta polypeptide, which shuttles electrons between primary flavoprotein dehydrogenases involved in mitochondrial fatty acid and amino acid catabolism and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. The gene deficiencies have been implicated in type II glutaricaciduria.

Molekulargewicht: 28 kDa (MW of target protein)