ETFB Antikörper (C-Term)

Produktnummer ABIN631031

Der Kaninchen Polyklonal anti-ETFB Antikörper wird verwendet zum Nachweis von ETFB in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für ETFB Antikörper (C-Term) (ABIN631031)

Target: ETFB (Electron-Transfer-Flavoprotein, beta Polypeptide (ETFB))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ETFB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ETFB Antikörper

Bindungsspezifität: C-Term

Spezifität: ETFB antibody was raised against the C terminal of ETFB

Aufreinigung: Affinity purified

Immunogen: ETFB antibody was raised using the C terminal of ETFB corresponding to a region with amino acids TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ETFB Blocking Peptide, (ABIN5613410), is also available for use as a blocking control in assays to test for specificity of this ETFB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ETFB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ETFB

Target: ETFB (Electron-Transfer-Flavoprotein, beta Polypeptide (ETFB))

Andere Bezeichnung: ETFB

Hintergrund: ETFB is the electron-transfer-flavoprotein, beta polypeptide, which shuttles electrons between primary flavoprotein dehydrogenases involved in mitochondrial fatty acid and amino acid catabolism and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. The gene deficiencies have been implicated in type II glutaricaciduria.

Molekulargewicht: 28 kDa (MW of target protein)