DLD Antikörper (Middle Region)

Produktnummer ABIN631024

Produktdetails anti-DLD Antikörper

Target: DLD (Dihydrolipoamide Dehydrogenase (DLD))

Bindungsspezifität: Middle Region

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DLD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DLD antibody was raised against the middle region of DLD

Aufreinigung: Affinity purified

Immunogen: DLD antibody was raised using the middle region of DLD corresponding to a region with amino acids AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DLD Blocking Peptide, catalog no. 33R-1194, is also available for use as a blocking control in assays to test for specificity of this DLD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DLD

Target: DLD (Dihydrolipoamide Dehydrogenase (DLD))

Andere Bezeichnung: DLD (DLD Produkte)

Synonyme: DLDD antikoerper, DLDH antikoerper, E3 antikoerper, GCSL antikoerper, LAD antikoerper, PHE3 antikoerper, AI315664 antikoerper, AI746344 antikoerper, wu:fb24b05 antikoerper, DLD antikoerper, DDBDRAFT_0183800 antikoerper, DDBDRAFT_0216232 antikoerper, DDB_0183800 antikoerper, DDB_0216232 antikoerper, sc:d0402 antikoerper, dihydrolipoamide dehydrogenase antikoerper, dihydrolipoyl dehydrogenase antikoerper, deltaD antikoerper, DLD antikoerper, Dld antikoerper, dldh antikoerper, AT4G16155 antikoerper, CND05840 antikoerper, bfmBC antikoerper, GCSL antikoerper, LACBIDRAFT_182385 antikoerper, UREG_06178 antikoerper, lpd antikoerper, TAGG_RS02070 antikoerper, Arnit_2606 antikoerper, Mesil_1945 antikoerper, Trad_2118 antikoerper, Acear_0640 antikoerper, Fbal_0372 antikoerper, Ilyop_1890 antikoerper, Ftrac_1733 antikoerper, Ocepr_1753 antikoerper, Intca_2017 antikoerper, Deima_0504 antikoerper, dld antikoerper

Hintergrund: DLD is the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Cell RedoxHomeostasis