MTX2 Antikörper (N-Term)

Produktnummer ABIN631023

Produktdetails anti-MTX2 Antikörper

Target: MTX2 (Metaxin 2 (MTX2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MTX2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Metaxin 2 antibody was raised against the N terminal of MTX2

Aufreinigung: Affinity purified

Immunogen: Metaxin 2 antibody was raised using the N terminal of MTX2 corresponding to a region with amino acids YIAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Metaxin 2 Blocking Peptide, catalog no. 33R-10130, is also available for use as a blocking control in assays to test for specificity of this Metaxin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTX2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MTX2

Target: MTX2 (Metaxin 2 (MTX2))

Andere Bezeichnung: Metaxin 2 (MTX2 Produkte)

Synonyme: wu:fc02d09 antikoerper, xmtx2 antikoerper, 1500012G02Rik antikoerper, metaxin 2 antikoerper, metaxin 2 L homeolog antikoerper, mtx2 antikoerper, mtx2.L antikoerper, MTX2 antikoerper, Mtx2 antikoerper

Hintergrund: MTX2 is highly similar to the metaxin 2 protein from mouse, which has been shown to interact with the mitochondrial membrane protein metaxin 1. Because of this similarity, it is thought that the encoded protein is peripherally associated with the cytosolic face of the outer mitochondrial membrane and be involved in the import of proteins into the mitochondrion.

Molekulargewicht: 29 kDa (MW of target protein)