WARS Antikörper (N-Term)

Produktnummer ABIN631021

Produktdetails anti-WARS Antikörper

Target: WARS (Tryptophanyl-tRNA Synthetase (WARS))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WARS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WARS antibody was raised against the N terminal of WARS

Aufreinigung: Affinity purified

Immunogen: WARS antibody was raised using the N terminal of WARS corresponding to a region with amino acids EIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WARS Blocking Peptide, catalog no. 33R-2465, is also available for use as a blocking control in assays to test for specificity of this WARS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WARS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WARS

Target: WARS (Tryptophanyl-tRNA Synthetase (WARS))

Andere Bezeichnung: WARS (WARS Produkte)

Synonyme: GAMMA-2 antikoerper, IFI53 antikoerper, IFP53 antikoerper, zgc:73274 antikoerper, wars antikoerper, MGC53671 antikoerper, WARS antikoerper, TrpRS antikoerper, WRS antikoerper, 85D-WRS antikoerper, CG9735 antikoerper, Dmel\\CG9735 antikoerper, WRS-85D antikoerper, l(3)03559 antikoerper, l(3)03560 antikoerper, l(3)3559 antikoerper, gamma-2 antikoerper, ifi53 antikoerper, ifp53 antikoerper, GB14934 antikoerper, ECK3371 antikoerper, JW3347 antikoerper, tryptophanyl-tRNA synthetase antikoerper, tryptophanyl-tRNA synthetase S homeolog antikoerper, Tryptophanyl-tRNA synthetase antikoerper, tryptophanyl-tRNA synthetase L homeolog antikoerper, tryptophan--tRNA ligase, cytoplasmic antikoerper, WARS antikoerper, wars antikoerper, wars.S antikoerper, Wars antikoerper, TrpRS antikoerper, wars.L antikoerper, LOC727582 antikoerper, trpS antikoerper, trpS2 antikoerper

Hintergrund: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family.

Molekulargewicht: 52 kDa (MW of target protein)