WARS Antikörper (N-Term)

Produktnummer ABIN631021

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch WARS in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für WARS Antikörper (N-Term) (ABIN631021)

Target: WARS (Tryptophanyl-tRNA Synthetase (WARS))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WARS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-WARS Antikörper

Bindungsspezifität: N-Term

Spezifität: WARS antibody was raised against the N terminal of WARS

Aufreinigung: Affinity purified

Immunogen: WARS antibody was raised using the N terminal of WARS corresponding to a region with amino acids EIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WARS Blocking Peptide, (ABIN937851), is also available for use as a blocking control in assays to test for specificity of this WARS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WARS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WARS

Target: WARS (Tryptophanyl-tRNA Synthetase (WARS))

Andere Bezeichnung: WARS

Hintergrund: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family.

Molekulargewicht: 52 kDa (MW of target protein)