MRPL10 Antikörper (N-Term)

Produktnummer ABIN631016

Produktdetails anti-MRPL10 Antikörper

Target: MRPL10 (Mitochondrial Ribosomal Protein L10 (MRPL10))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MRPL10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MRPL10 antibody was raised against the N terminal of MRPL10

Aufreinigung: Affinity purified

Immunogen: MRPL10 antibody was raised using the N terminal of MRPL10 corresponding to a region with amino acids HRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGLIRLLRRE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MRPL10 Blocking Peptide, catalog no. 33R-3847, is also available for use as a blocking control in assays to test for specificity of this MRPL10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MRPL10

Target: MRPL10 (Mitochondrial Ribosomal Protein L10 (MRPL10))

Andere Bezeichnung: MRPL10 (MRPL10 Produkte)

Synonyme: CG11488 antikoerper, Dmel\\CG11488 antikoerper, L10 antikoerper, 0610040E02Rik antikoerper, C78440 antikoerper, MRP-L8 antikoerper, Rpml8 antikoerper, L10MT antikoerper, MRP-L10 antikoerper, MRPL8 antikoerper, RPML8 antikoerper, L10mt antikoerper, zgc:112529 antikoerper, MRPL18 antikoerper, mitochondrial ribosomal protein L10 antikoerper, mitochondrial ribosomal protein L10 S homeolog antikoerper, mitochondrial 54S ribosomal protein YmL10/YmL18 antikoerper, mitochondrial ribosomal protein subunit L15 (predicted) antikoerper, mRpL10 antikoerper, Mrpl10 antikoerper, MRPL10 antikoerper, mrpl10.S antikoerper, mrpl10 antikoerper

Hintergrund: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 5q.

Molekulargewicht: 29 kDa (MW of target protein)