LACTB Antikörper (C-Term)

Produktnummer ABIN631015

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch LACTB in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für LACTB Antikörper (C-Term) (ABIN631015)

Target: LACTB (Lactamase, beta (LACTB))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LACTB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LACTB Antikörper

Bindungsspezifität: C-Term

Spezifität: Beta Lactamase antibody was raised against the C terminal of LACTB

Aufreinigung: Affinity purified

Immunogen: Beta Lactamase antibody was raised using the C terminal of LACTB corresponding to a region with amino acids TEMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAVGASSVLLVL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Beta Lactamase Blocking Peptide, (ABIN5612321), is also available for use as a blocking control in assays to test for specificity of this Beta Lactamase antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LACTB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LACTB

Target: LACTB (Lactamase, beta (LACTB))

Andere Bezeichnung: beta Lactamase

Hintergrund: LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.

Molekulargewicht: 61 kDa (MW of target protein)