TST Antikörper

Produktnummer ABIN631012

Produktdetails anti-TST Antikörper

Target: TST (Thiosulfate Sulfurtransferase (Rhodanese) (TST))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TST Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: TST antibody was raised using a synthetic peptide corresponding to a region with amino acids GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TST Blocking Peptide, catalog no. 33R-3229, is also available for use as a blocking control in assays to test for specificity of this TST antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TST antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TST

Target: TST (Thiosulfate Sulfurtransferase (Rhodanese) (TST))

Andere Bezeichnung: TST (TST Produkte)

Synonyme: RDS antikoerper, cysA antikoerper, SCD66.01 antikoerper, SCD84.31 antikoerper, An12g01520 antikoerper, SPCP25A2.01c antikoerper, AO090010000212 antikoerper, Rhodanese antikoerper, RHODAN antikoerper, thiosulfate sulfurtransferase antikoerper, thiosulfate sulfurtransferase, involved in tRNA wobble position thiolation Tum1 (predicted) antikoerper, Thiosulfate sulfurtransferase antikoerper, thiosulfate sulfurtransferase, mitochondrial antikoerper, TST antikoerper, SCO4164 antikoerper, CND03690 antikoerper, ANI_1_218104 antikoerper, tum1 antikoerper, AOR_1_380024 antikoerper, Deipr_0023 antikoerper, Marky_1331 antikoerper, Tst antikoerper

Hintergrund: TST is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.

Molekulargewicht: 33 kDa (MW of target protein)