Coilin Antikörper (C-Term)

Produktnummer ABIN631002

Produktdetails anti-Coilin Antikörper

Target: Coilin (COIL)

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Coilin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Coilin antibody was raised against the C terminal of COIL

Aufreinigung: Affinity purified

Immunogen: Coilin antibody was raised using the C terminal of COIL corresponding to a region with amino acids DYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Coilin Blocking Peptide, catalog no. 33R-2247, is also available for use as a blocking control in assays to test for specificity of this Coilin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COIL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Coilin

Target: Coilin (COIL)

Andere Bezeichnung: Coilin (COIL Produkte)

Synonyme: p80c antikoerper, coil antikoerper, CG8710 antikoerper, Coilin antikoerper, Dmel\\CG8710 antikoerper, LOC100218802 antikoerper, F3F19.5 antikoerper, F3F19_5 antikoerper, CLN80 antikoerper, p80-coilin antikoerper, C79982 antikoerper, Cln80 antikoerper, p80 antikoerper, wu:fb08h11 antikoerper, sph1 antikoerper, Coilin antikoerper, coilin antikoerper, sphere organelles protein-like protein antikoerper, coilin p80 antikoerper, coilin L homeolog antikoerper, p80c antikoerper, COIL antikoerper, coil antikoerper, AT1G13030 antikoerper, Coil antikoerper, coil.L antikoerper

Hintergrund: COIL is an integral component of Cajal bodies (also called coiled bodies). Cajal bodies are nuclear suborganelles of varying number and composition that are involved in the post-transcriptional modification of small nuclear and small nucleolar RNAs. The N-terminus of the coilin protein directs its self-oligomerization while the C-terminus influences the number of nuclear bodies assembled per cell. Differential methylation and phosphorylation of coilin likely influences its localization among nuclear bodies and the composition and assembly of Cajal bodies.

Molekulargewicht: 63 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization