ALAS1 Antikörper (N-Term)

Produktnummer ABIN631001

Der Kaninchen Polyklonal Anti-ALAS1-Antikörper wurde für WB validiert. Er ist geeignet, ALAS1 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für ALAS1 Antikörper (N-Term) (ABIN631001)

Target: ALAS1 (Aminolevulinate, delta-, Synthase 1 (ALAS1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALAS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ALAS1 Antikörper

Bindungsspezifität: N-Term

Spezifität: ALAS1 antibody was raised against the N terminal of ALAS1

Aufreinigung: Affinity purified

Immunogen: ALAS1 antibody was raised using the N terminal of ALAS1 corresponding to a region with amino acids ETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALAS1 Blocking Peptide, (ABIN938155), is also available for use as a blocking control in assays to test for specificity of this ALAS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALAS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALAS1

Target: ALAS1 (Aminolevulinate, delta-, Synthase 1 (ALAS1))

Andere Bezeichnung: ALAS1

Hintergrund: Delta-aminolevulinate synthase (ALAS, EC 2.3.1.37) catalyzes the condensation of glycine with succinyl-CoA to form delta-aminolevulinic acid. This nuclear-encoded mitochondrial enzyme is the first and rate-limiting enzyme in the mammalian heme biosynthetic pathway. There are 2 tissue-specific isozymes: a housekeeping enzyme encoded by the ALAS1 gene and an erythroid tissue-specific enzyme encoded by ALAS2.

Molekulargewicht: 70 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha