MRPL37 Antikörper (N-Term)

Produktnummer ABIN630997

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MRPL37 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für MRPL37 Antikörper (N-Term) (ABIN630997)

Target: MRPL37 (Mitochondrial Ribosomal Protein L37 (MRPL37))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MRPL37 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MRPL37 Antikörper

Bindungsspezifität: N-Term

Spezifität: MRPL37 antibody was raised against the N terminal of MRPL37

Aufreinigung: Affinity purified

Immunogen: MRPL37 antibody was raised using the N terminal of MRPL37 corresponding to a region with amino acids VRSTRKSEPPPLDRVYEIPGLEPITFAGKMHFVPWLARPIFPPWDRGYKD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MRPL37 Blocking Peptide, (ABIN5614842), is also available for use as a blocking control in assays to test for specificity of this MRPL37 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL37 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MRPL37

Target: MRPL37 (Mitochondrial Ribosomal Protein L37 (MRPL37))

Andere Bezeichnung: MRPL37

Hintergrund: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.

Molekulargewicht: 48 kDa (MW of target protein)