Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

MRPL15 Antikörper (N-Term)

Der Kaninchen Polyklonal Anti-MRPL15-Antikörper wurde für WB validiert. Er ist geeignet, MRPL15 in Proben von Human, Maus und Ratte zu detektieren.
Produktnummer ABIN630995

Kurzübersicht für MRPL15 Antikörper (N-Term) (ABIN630995)

Target

Alle MRPL15 Antikörper anzeigen
MRPL15 (Mitochondrial Ribosomal Protein L15 (MRPL15))

Reaktivität

  • 23
  • 16
  • 6
  • 4
  • 4
  • 4
  • 3
  • 3
  • 3
  • 3
  • 3
  • 2
  • 1
  • 1
Human, Maus, Ratte

Wirt

  • 20
  • 3
Kaninchen

Klonalität

  • 20
  • 3
Polyklonal

Konjugat

  • 16
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Dieser MRPL15 Antikörper ist unkonjugiert

Applikation

  • 16
  • 6
  • 5
  • 4
  • 3
  • 3
  • 2
  • 1
Western Blotting (WB)
  • Bindungsspezifität

    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    N-Term

    Spezifität

    MRPL15 antibody was raised against the N terminal of MRPL15

    Aufreinigung

    Affinity purified

    Immunogen

    MRPL15 antibody was raised using the N terminal of MRPL15 corresponding to a region with amino acids KPERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYIRIPKYGFN
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    MRPL15 Blocking Peptide, (ABIN939969), is also available for use as a blocking control in assays to test for specificity of this MRPL15 antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL15 antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    MRPL15 (Mitochondrial Ribosomal Protein L15 (MRPL15))

    Andere Bezeichnung

    MRPL15

    Hintergrund

    Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPL15 belongs to the ribosomal protein L15P family. It is a 39S subunit protein that belongs to the EcoL15 ribosomal protein family.

    Molekulargewicht

    33 kDa (MW of target protein)
Sie sind hier:
Chat with us!