MRPL15 Antikörper (N-Term)

Produktnummer ABIN630995

Der Kaninchen Polyklonal Anti-MRPL15-Antikörper wurde für WB validiert. Er ist geeignet, MRPL15 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für MRPL15 Antikörper (N-Term) (ABIN630995)

Target: MRPL15 (Mitochondrial Ribosomal Protein L15 (MRPL15))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MRPL15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MRPL15 Antikörper

Bindungsspezifität: N-Term

Spezifität: MRPL15 antibody was raised against the N terminal of MRPL15

Aufreinigung: Affinity purified

Immunogen: MRPL15 antibody was raised using the N terminal of MRPL15 corresponding to a region with amino acids KPERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYIRIPKYGFN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MRPL15 Blocking Peptide, (ABIN939969), is also available for use as a blocking control in assays to test for specificity of this MRPL15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MRPL15

Target: MRPL15 (Mitochondrial Ribosomal Protein L15 (MRPL15))

Andere Bezeichnung: MRPL15

Hintergrund: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPL15 belongs to the ribosomal protein L15P family. It is a 39S subunit protein that belongs to the EcoL15 ribosomal protein family.

Molekulargewicht: 33 kDa (MW of target protein)