WBP2NL Antikörper (N-Term)

Produktnummer ABIN630989

Der Kaninchen Polyklonal Anti-WBP2NL-Antikörper wurde für WB validiert. Er ist geeignet, WBP2NL in Proben von Human zu detektieren.

Kurzübersicht für WBP2NL Antikörper (N-Term) (ABIN630989)

Target: WBP2NL (WBP2 N-terminal Like (WBP2NL))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WBP2NL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-WBP2NL Antikörper

Bindungsspezifität: N-Term

Spezifität: WBP2 NL antibody was raised against the N terminal of WBP2 L

Aufreinigung: Affinity purified

Immunogen: WBP2 NL antibody was raised using the N terminal of WBP2 L corresponding to a region with amino acids MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WBP2NL Blocking Peptide, (ABIN5616991), is also available for use as a blocking control in assays to test for specificity of this WBP2NL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WBP0 L antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WBP2NL

Target: WBP2NL (WBP2 N-terminal Like (WBP2NL))

Andere Bezeichnung: WBP2NL

Hintergrund: WBP2NL may play a role in meotic resumption and pronuclear formation, mediated by a WW domain-signaling pathway during fertilization.

Molekulargewicht: 32 kDa (MW of target protein)