WBP2NL Antikörper (N-Term)
-
- Target Alle WBP2NL Antikörper anzeigen
- WBP2NL (WBP2 N-terminal Like (WBP2NL))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser WBP2NL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- WBP2 NL antibody was raised against the N terminal of WBP2 L
- Aufreinigung
- Affinity purified
- Immunogen
- WBP2 NL antibody was raised using the N terminal of WBP2 L corresponding to a region with amino acids MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGT
- Top Product
- Discover our top product WBP2NL Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
WBP2NL Blocking Peptide, catalog no. 33R-5799, is also available for use as a blocking control in assays to test for specificity of this WBP2NL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WBP0 L antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WBP2NL (WBP2 N-terminal Like (WBP2NL))
- Andere Bezeichnung
- WBP2NL (WBP2NL Produkte)
- Hintergrund
- WBP2NL may play a role in meotic resumption and pronuclear formation, mediated by a WW domain-signaling pathway during fertilization.
- Molekulargewicht
- 32 kDa (MW of target protein)
-