WARS2 Antikörper (Middle Region)

Produktnummer ABIN630987

Dieser Anti-WARS2-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von WARS2 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für WARS2 Antikörper (Middle Region) (ABIN630987)

Target: WARS2 (Tryptophanyl tRNA Synthetase 2, Mitochondrial (WARS2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WARS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-WARS2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: WARS2 antibody was raised against the middle region of WARS2

Aufreinigung: Affinity purified

Immunogen: WARS2 antibody was raised using the middle region of WARS2 corresponding to a region with amino acids TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WARS2 Blocking Peptide, (ABIN5616987), is also available for use as a blocking control in assays to test for specificity of this WARS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WARS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WARS2

Target: WARS2 (Tryptophanyl tRNA Synthetase 2, Mitochondrial (WARS2))

Andere Bezeichnung: WARS2

Hintergrund: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. WARS2 is the mitochondrial tryptophanyl-tRNA synthetase.

Molekulargewicht: 24 kDa (MW of target protein)