OXSM Antikörper (Middle Region)

Produktnummer ABIN630986

Produktdetails anti-OXSM Antikörper

Target: OXSM (3-Oxoacyl-ACP Synthase, Mitochondrial (OXSM))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OXSM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OXSM antibody was raised against the middle region of OXSM

Aufreinigung: Affinity purified

Immunogen: OXSM antibody was raised using the middle region of OXSM corresponding to a region with amino acids HAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OXSM Blocking Peptide, catalog no. 33R-3696, is also available for use as a blocking control in assays to test for specificity of this OXSM antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OXSM antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OXSM

Target: OXSM (3-Oxoacyl-ACP Synthase, Mitochondrial (OXSM))

Andere Bezeichnung: OXSM (OXSM Produkte)

Synonyme: FASN2D antikoerper, KASI antikoerper, KS antikoerper, 4933425A18Rik antikoerper, C80494 antikoerper, RGD1311092 antikoerper, fatty acid synthase antikoerper, 3-oxoacyl-ACP synthase, mitochondrial antikoerper, FASN antikoerper, OXSM antikoerper, oxsm antikoerper, Oxsm antikoerper

Hintergrund: OXSM is a mitochondrial beta-ketoacyl synthase (EC 2.3.1.41) involved in mitochondrial fatty acid synthesis. It is required for catalysis of the chain-elongating condensation reaction.

Molekulargewicht: 49 kDa (MW of target protein)